PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSVIVT01020604001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; rosids incertae sedis; Vitales; Vitaceae; Vitis
Family G2-like
Protein Properties Length: 372aa    MW: 41159.1 Da    PI: 10.5808
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSVIVT01020604001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like889e-2894148156
            G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRla 56 
                        k +++WtpeLH+rFv+aveqL G +kA+P++ile+m++++Lt+++++SHLQkYR++
  GSVIVT01020604001  94 KVKVDWTPELHRRFVQAVEQL-GVDKAVPSRILEIMGIDCLTRHNIASHLQKYRSH 148
                        5689*****************.********************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129418.04291150IPR017930Myb domain
SuperFamilySSF466893.76E-1892151IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.3E-2692151IPR009057Homeodomain-like
TIGRFAMsTIGR015571.1E-2694148IPR006447Myb domain, plants
PfamPF002491.1E-797146IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0007165Biological Processsignal transduction
GO:0009658Biological Processchloroplast organization
GO:0009910Biological Processnegative regulation of flower development
GO:0010380Biological Processregulation of chlorophyll biosynthetic process
GO:0010638Biological Processpositive regulation of organelle organization
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:1900056Biological Processnegative regulation of leaf senescence
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 372 aa     Download sequence    Send to blast
MTSRTSMKGT CSNVSISTIF SSAYTTERYC RTWRWTQKFS LNFPLAPEKN PTSSRGEEIV  60
SKRSESVATN ASPKEVEKGR KSSAQSKNPQ GKRKVKVDWT PELHRRFVQA VEQLGVDKAV  120
PSRILEIMGI DCLTRHNIAS HLQKYRSHRK HLLAREAEAA SWSQKRQMYG VAAGGGGHKR  180
EMGGWIPPTM GFPHITPMHH HPFRPLHVWG HPTVDQSAMH MWPKHLPHSP SPPPPPPPTW  240
PPSATPPSPS PDPYWHPHHQ RVPNGLTQGT PCFPQPLAAA RFATPPVTGI PPHPMYKVDH  300
NHPGIGVPAR HSGPFPLFDF HPSKETIDAA IGDALSKPWQ PLPLGLKPPS LDGVMVELQR  360
QGVPKIPPTC A*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1irz_A1e-1591146257ARR10-B
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Vvi.68640.0bud| flower| fruit| leaf
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00022PBMTransfer from AT2G20570Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAM4279740.0AM427974.2 Vitis vinifera contig VV78X013729.10, whole genome shotgun sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002275230.10.0PREDICTED: transcription activator GLK1
SwissprotQ9SIV34e-97GLK1_ARATH; Transcription activator GLK1
TrEMBLF6H5G90.0F6H5G9_VITVI; Putative uncharacterized protein
STRINGVIT_12s0028g03100.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP28401529
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G20570.11e-81GBF's pro-rich region-interacting factor 1